SLC30A3 antibody

Name SLC30A3 antibody
Supplier Fitzgerald
Catalog 70R-6762
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SLC30A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMLLTASIAVCANLLMAFVLHQAGPPHSHGSRGAEYAPLEEGPEEPLPLG
Purity/Format Affinity purified
Blocking Peptide SLC30A3 Blocking Peptide
Description Rabbit polyclonal SLC30A3 antibody
Gene SLC30A3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.