| Name | UPB1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1078 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Arabidopsis thaliana, C. elegans, Drosophila, Zebrafish |
| Antigen | UPB1 antibody was raised using the middle region of UPB1 corresponding to a region with amino acids AVVISNSGAVLGKTRKNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAV |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | UPB1 Blocking Peptide |
| Description | Rabbit polyclonal UPB1 antibody raised against the middle region of UPB1 |
| Gene | UPB1 |
| Supplier Page | Shop |