TBC1D21 antibody

Name TBC1D21 antibody
Supplier Fitzgerald
Catalog 70R-4188
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen TBC1D21 antibody was raised using the N terminal of TBC1D21 corresponding to a region with amino acids MTTLSPENSLSARQSASFILVKRKPPIDKTEWDSFFDESGHLAKSRDFIC
Purity/Format Affinity purified
Blocking Peptide TBC1D21 Blocking Peptide
Description Rabbit polyclonal TBC1D21 antibody raised against the N terminal of TBC1D21
Gene TBC1D21
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.