| Name | PRPS2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1270 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Drosophila |
| Antigen | PRPS2 antibody was raised using the middle region of PRPS2 corresponding to a region with amino acids ENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMV |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | PRPS2 Blocking Peptide |
| Description | Rabbit polyclonal PRPS2 antibody raised against the middle region of PRPS2 |
| Gene | PRPS2 |
| Supplier Page | Shop |