CEACAM6 antibody

Name CEACAM6 antibody
Supplier Fitzgerald
Catalog 70R-3099
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen CEACAM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVI
Purity/Format Affinity purified
Blocking Peptide CEACAM6 Blocking Peptide
Description Rabbit polyclonal CEACAM6 antibody
Gene CEACAM6
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.