Chondroadherin antibody

Name Chondroadherin antibody
Supplier Fitzgerald
Catalog 70R-5470
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen Chondroadherin antibody was raised using the middle region of CHAD corresponding to a region with amino acids LSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALD
Purity/Format Affinity purified
Blocking Peptide Chondroadherin Blocking Peptide
Description Rabbit polyclonal Chondroadherin antibody raised against the middle region of CHAD
Gene CHAD
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.