| Name | PYGB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2554 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PYGB antibody was raised using the N terminal of PYGB corresponding to a region with amino acids QQHYYERDPKRIYYLSLEFYMGRTLQNTMVNLGLQNACDEAIYQLGLDLE |
| Purity/Format | Affinity purified |
| Blocking Peptide | PYGB Blocking Peptide |
| Description | Rabbit polyclonal PYGB antibody raised against the N terminal of PYGB |
| Gene | PYGB |
| Supplier Page | Shop |