C4ORF20 antibody

Name C4ORF20 antibody
Supplier Fitzgerald
Catalog 70R-3548
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen C4ORF20 antibody was raised using the middle region of C4Orf20 corresponding to a region with amino acids TPVMIGGGVLAHTILGVAWNEITGQIKFLILDPHYTGAEDLQVILEKGWC
Purity/Format Affinity purified
Blocking Peptide C4ORF20 Blocking Peptide
Description Rabbit polyclonal C4ORF20 antibody raised against the middle region of C4Orf20
Gene UFSP2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.