Name | SNUPN antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4636 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | SNUPN antibody was raised using the middle region of SNUPN corresponding to a region with amino acids GVAVPAGPLTTKPDYAGHQLQQIMEHKKSQKEGMKEKLTHKASENGHYEL |
Purity/Format | Affinity purified |
Blocking Peptide | SNUPN Blocking Peptide |
Description | Rabbit polyclonal SNUPN antibody raised against the middle region of SNUPN |
Gene | SNUPN |
Supplier Page | Shop |