ABCC9 antibody

Name ABCC9 antibody
Supplier Fitzgerald
Catalog 70R-6250
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen ABCC9 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK
Purity/Format Affinity purified
Blocking Peptide ABCC9 Blocking Peptide
Description Rabbit polyclonal ABCC9 antibody
Gene ABCC9
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.