Carbonic Anhydrase VIII antibody

• Supplier: Fitzgerald
• Catalog: 70R-2586
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human, Mouse, Rat
• Antigen: Carbonic Anhydrase VIII antibody was raised using the middle region of CA8 corresponding to a region with amino acids TISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
• Purity/Format: Affinity purified
• Blocking Peptide: Carbonic Anhydrase VIII Blocking Peptide
• Description: Rabbit polyclonal Carbonic Anhydrase VIII antibody raised against the middle region of CA8
• Gene: CA8