| Name | SLC35B1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1849 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | SLC35B1 antibody was raised using the C terminal of SLC35B1 corresponding to a region with amino acids ALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGT |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | SLC35B1 Blocking Peptide |
| Description | Rabbit polyclonal SLC35B1 antibody raised against the C terminal of SLC35B1 |
| Gene | SLC35B1 |
| Supplier Page | Shop |