YTHDF3 antibody

Name YTHDF3 antibody
Supplier Fitzgerald
Catalog 70R-3323
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen YTHDF3 antibody was raised using the N terminal of YTHDF3 corresponding to a region with amino acids GEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLGQ
Purity/Format Affinity purified
Blocking Peptide YTHDF3 Blocking Peptide
Description Rabbit polyclonal YTHDF3 antibody raised against the N terminal of YTHDF3
Gene YTHDF3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.