| Name | KCNA1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5148 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | KCNA1 antibody was raised using the middle region of KCNA1 corresponding to a region with amino acids ISIVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFTDPFFIVETLC |
| Purity/Format | Affinity purified |
| Blocking Peptide | KCNA1 Blocking Peptide |
| Description | Rabbit polyclonal KCNA1 antibody raised against the middle region of KCNA1 |
| Gene | KCNA1 |
| Supplier Page | Shop |