| Name | TTC16 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2970 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TTC16 antibody was raised using the C terminal of TTC16 corresponding to a region with amino acids RSRGLLRSSTKTEAFYDSNWSLSKTEYAQGQGQRSSKAEGAQGKSQGMSS |
| Purity/Format | Affinity purified |
| Blocking Peptide | TTC16 Blocking Peptide |
| Description | Rabbit polyclonal TTC16 antibody raised against the C terminal of TTC16 |
| Gene | TTC16 |
| Supplier Page | Shop |