Name | BTNL9 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7019 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | BTNL9 antibody was raised using the N terminal of BTNL9 corresponding to a region with amino acids EIRWFRSQTFNVVHLYQEQQELPGRQMPAFRNRTKLVKDDIAYGSVVLQL |
Purity/Format | Affinity purified |
Blocking Peptide | BTNL9 Blocking Peptide |
Description | Rabbit polyclonal BTNL9 antibody raised against the N terminal of BTNL9 |
Gene | BTNL9 |
Supplier Page | Shop |