| Name | PDE1C antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2073 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PDE1C antibody was raised using the middle region of PDE1C corresponding to a region with amino acids IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR |
| Purity/Format | Affinity purified |
| Blocking Peptide | PDE1C Blocking Peptide |
| Description | Rabbit polyclonal PDE1C antibody raised against the middle region of PDE1C |
| Gene | PDE1C |
| Supplier Page | Shop |