| Name | C4ORF22 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4252 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | C4ORF22 antibody was raised using the N terminal Of C4Orf22 corresponding to a region with amino acids YLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQKTLT |
| Purity/Format | Affinity purified |
| Blocking Peptide | C4ORF22 Blocking Peptide |
| Description | Rabbit polyclonal C4ORF22 antibody raised against the N terminal Of C4Orf22 |
| Gene | C4orf22 |
| Supplier Page | Shop |