ANKRD37 antibody

Name ANKRD37 antibody
Supplier Fitzgerald
Catalog 70R-3163
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ANKRD37 antibody was raised using the middle region of ANKRD37 corresponding to a region with amino acids GFPDCAKFLTTIKCMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRK
Purity/Format Affinity purified
Blocking Peptide ANKRD37 Blocking Peptide
Description Rabbit polyclonal ANKRD37 antibody raised against the middle region of ANKRD37
Gene ANKRD37
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.