| Name | KIF1A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5534 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | KIF1A antibody was raised using the N terminal of KIF1A corresponding to a region with amino acids TTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQH |
| Purity/Format | Affinity purified |
| Blocking Peptide | KIF1A Blocking Peptide |
| Description | Rabbit polyclonal KIF1A antibody raised against the N terminal of KIF1A |
| Gene | KIF1A |
| Supplier Page | Shop |