| Name | C20ORF111 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4348 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | C20ORF111 antibody was raised using the N terminal Of C20Orf111 corresponding to a region with amino acids RGAVRTQRRRRSKSPVLHPPKFIHCSTIASSSSSQLKHKSQTDSPDGSSG |
| Purity/Format | Affinity purified |
| Blocking Peptide | C20ORF111 Blocking Peptide |
| Description | Rabbit polyclonal C20ORF111 antibody raised against the N terminal Of C20Orf111 |
| Gene | OSER1 |
| Supplier Page | Shop |