Occludin antibody

Name Occludin antibody
Supplier Fitzgerald
Catalog 70R-1721
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Dog
Antigen Occludin antibody was raised using the N terminal of OCLN corresponding to a region with amino acids MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPED
Purity/Format Total IgG Protein A purified
Blocking Peptide Occludin Blocking Peptide
Description Rabbit polyclonal Occludin antibody raised against the N terminal of OCLN
Gene OCLN
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.