| Name | C12ORF11 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4092 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C12ORF11 antibody was raised using the middle region of C12Orf11 corresponding to a region with amino acids VQQHFDLASTTITNIPMKEEQHANTSANYDVELLHHKDAHVDFLKSGDSH |
| Purity/Format | Affinity purified |
| Blocking Peptide | C12ORF11 Blocking Peptide |
| Description | Rabbit polyclonal C12ORF11 antibody raised against the middle region of C12Orf11 |
| Gene | ASUN |
| Supplier Page | Shop |