Name | DPYS antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1174 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | DPYS antibody was raised using the middle region of DPYS corresponding to a region with amino acids LRPDPSTPDFLMNLLANDDLTTTGTDNCTFNTCQKALGKDDFTKIPNGVN |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | DPYS Blocking Peptide |
Description | Rabbit polyclonal DPYS antibody raised against the middle region of DPYS |
Gene | DPYS |
Supplier Page | Shop |