| Name | TRIB1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3676 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TRIB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA |
| Purity/Format | Affinity purified |
| Blocking Peptide | TRIB1 Blocking Peptide |
| Description | Rabbit polyclonal TRIB1 antibody |
| Gene | TRIB1 |
| Supplier Page | Shop |