| Name | RHAG antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1913 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RHAG antibody was raised using the middle region of RHAG corresponding to a region with amino acids FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | RHAG Blocking Peptide |
| Description | Rabbit polyclonal RHAG antibody raised against the middle region of RHAG |
| Gene | RHAG |
| Supplier Page | Shop |