TMED8 antibody

Name TMED8 antibody
Supplier Fitzgerald
Catalog 70R-4289
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen TMED8 antibody was raised using the middle region of TMED8 corresponding to a region with amino acids EVMPVYRRDSHRDVQAGSHDYPGEGIYLLKFDNSYSLLRNKTLYFHIYYT
Purity/Format Affinity purified
Blocking Peptide TMED8 Blocking Peptide
Description Rabbit polyclonal TMED8 antibody raised against the middle region of TMED8
Gene TMED8
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.