TJP2 antibody

Name TJP2 antibody
Supplier Fitzgerald
Catalog 70R-2655
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Dog
Antigen TJP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TVVPETNKEPRYQEDPPAPQPKAAPRTFLRPSPEDEAIYGPNTKMVRFKK
Purity/Format Affinity purified
Blocking Peptide TJP2 Blocking Peptide
Description Rabbit polyclonal TJP2 antibody
Gene TJP2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.