DDX28 antibody

Name DDX28 antibody
Supplier Fitzgerald
Catalog 70R-5025
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen DDX28 antibody was raised using a synthetic peptide corresponding to a region with amino acids FSIERAQQEAPAVRKLSSKGSFADLGLEPRVLHALQEAAPEVVQPTTVQS
Purity/Format Affinity purified
Blocking Peptide DDX28 Blocking Peptide
Description Rabbit polyclonal DDX28 antibody
Gene DDX28
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.