| Name | PCDHA12 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6159 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | PCDHA12 antibody was raised using the N terminal of PCDHA12 corresponding to a region with amino acids EVIVDRPLQVFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEG |
| Purity/Format | Affinity purified |
| Blocking Peptide | PCDHA12 Blocking Peptide |
| Description | Rabbit polyclonal PCDHA12 antibody raised against the N terminal of PCDHA12 |
| Gene | PCDHA12 |
| Supplier Page | Shop |