DPH2 antibody

Name DPH2 antibody
Supplier Fitzgerald
Catalog 70R-3392
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen DPH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CLSPPARPLPVAFVLRQRSVALELCVKAFEAQNPDPKAPVVLLSEPACAH
Purity/Format Affinity purified
Blocking Peptide DPH2 Blocking Peptide
Description Rabbit polyclonal DPH2 antibody
Gene DPH2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.