CENTB5 antibody

Name CENTB5 antibody
Supplier Fitzgerald
Catalog 70R-4129
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen CENTB5 antibody was raised using the N terminal of CENTB5 corresponding to a region with amino acids LQSFVKEDVRKFKETKKQFDKVREDLELSLVRNAQAPRHRPHEVEEATGA
Purity/Format Affinity purified
Blocking Peptide CENTB5 Blocking Peptide
Description Rabbit polyclonal CENTB5 antibody raised against the N terminal of CENTB5
Gene ACAP3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.