| Name | CENTB5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4129 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | CENTB5 antibody was raised using the N terminal of CENTB5 corresponding to a region with amino acids LQSFVKEDVRKFKETKKQFDKVREDLELSLVRNAQAPRHRPHEVEEATGA |
| Purity/Format | Affinity purified |
| Blocking Peptide | CENTB5 Blocking Peptide |
| Description | Rabbit polyclonal CENTB5 antibody raised against the N terminal of CENTB5 |
| Gene | ACAP3 |
| Supplier Page | Shop |