Cytokeratin 75 antibody

• Supplier: Fitzgerald
• Catalog: 70R-3039
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Cytokeratin 75 antibody was raised using the middle region of KRT75 corresponding to a region with amino acids SFTTSGGHSLGAGLGGSGFSATSNRGLGGSGSSVKFVSTTSSSQKSYTH
• Purity/Format: Affinity purified
• Blocking Peptide: Cytokeratin 75 Blocking Peptide
• Description: Rabbit polyclonal Cytokeratin 75 antibody raised against the middle region of KRT75
• Gene: KRT75