Name | Cytokeratin 75 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3039 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Cytokeratin 75 antibody was raised using the middle region of KRT75 corresponding to a region with amino acids SFTTSGGHSLGAGLGGSGFSATSNRGLGGSGSSVKFVSTTSSSQKSYTH |
Purity/Format | Affinity purified |
Blocking Peptide | Cytokeratin 75 Blocking Peptide |
Description | Rabbit polyclonal Cytokeratin 75 antibody raised against the middle region of KRT75 |
Gene | KRT75 |
Supplier Page | Shop |