Name | SFTPB antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-5411 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Rat |
Antigen | SFTPB antibody was raised using the middle region of SFTPB corresponding to a region with amino acids PGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAV |
Purity/Format | Affinity purified |
Blocking Peptide | SFTPB Blocking Peptide |
Description | Rabbit polyclonal SFTPB antibody raised against the middle region of SFTPB |
Gene | SFTPB |
Supplier Page | Shop |