SFTPB antibody

Name SFTPB antibody
Supplier Fitzgerald
Catalog 70R-5411
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat
Antigen SFTPB antibody was raised using the middle region of SFTPB corresponding to a region with amino acids PGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAV
Purity/Format Affinity purified
Blocking Peptide SFTPB Blocking Peptide
Description Rabbit polyclonal SFTPB antibody raised against the middle region of SFTPB
Gene SFTPB
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.