| Name | KCTD19 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5057 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | KCTD19 antibody was raised using the N terminal of KCTD19 corresponding to a region with amino acids DSLLWKEASALTSSESQRLFIDRDGSTFRHVHYYLYTSKLSFSSCAELNL |
| Purity/Format | Affinity purified |
| Blocking Peptide | KCTD19 Blocking Peptide |
| Description | Rabbit polyclonal KCTD19 antibody raised against the n terminal of KCTD19 |
| Gene | KCTD19 |
| Supplier Page | Shop |