PH4 antibody

Name PH4 antibody
Supplier Fitzgerald
Catalog 70R-7089
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen PH4 antibody was raised using the middle region of PH-4 corresponding to a region with amino acids GHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRYMTVLFYLNNVTGG
Purity/Format Affinity purified
Blocking Peptide PH4 Blocking Peptide
Description Rabbit polyclonal PH4 antibody raised against the middle region of PH-4
Gene P4HTM
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.