| Name | RWDD2A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3777 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | RWDD2A antibody was raised using the N terminal of RWDD2A corresponding to a region with amino acids NALTNIKRYLEGTREALPPKIEFVITLQIEEPKVKIDLQVTMPHSYPYVA |
| Purity/Format | Affinity purified |
| Blocking Peptide | RWDD2A Blocking Peptide |
| Description | Rabbit polyclonal RWDD2A antibody raised against the N terminal of RWDD2A |
| Gene | RWDD2A |
| Supplier Page | Shop |