Anti-Glyt2 antibody
| Name | Anti-Glyt2 antibody |
|---|---|
| Supplier | Abcam |
| Catalog | ab99098 |
| Prices | $370.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Rabbit, Horse, Chicken, Guinea Pig, Bovine, Cat, Dog |
| Antigen | Synthetic peptide corresponding to a region within internal amino acids 503-552 ( LIVTCTNSATSIFAGFVIFSVIGFMANERKVNIENVADQGPGIAFVVYPE ) of Human Glyt2 (NP_004202) |
| Description | Rabbit Polyclonal |
| Gene | SLC6A5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
Anti-Glyt2 antibody (ab99098) at 1 µg/ml + PANC1 cell lysate at 10 µg