| Name | Gamma Tubulin 2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4513 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Gamma Tubulin 2 antibody was raised using the middle region of TUBG2 corresponding to a region with amino acids FDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYI |
| Purity/Format | Affinity purified |
| Blocking Peptide | Gamma Tubulin 2 Blocking Peptide |
| Description | Rabbit polyclonal Gamma Tubulin 2 antibody raised against the middle region of TUBG2 |
| Gene | TUBG2 |
| Supplier Page | Shop |