| Name | MPPED2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5250 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | MPPED2 antibody was raised using the C terminal of MPPED2 corresponding to a region with amino acids PKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS |
| Purity/Format | Affinity purified |
| Blocking Peptide | MPPED2 Blocking Peptide |
| Description | Rabbit polyclonal MPPED2 antibody raised against the C terminal of MPPED2 |
| Gene | MPPED2 |
| Supplier Page | Shop |