| Name | C1ORF93 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4161 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C1ORF93 antibody was raised using the middle region of C1Orf93 corresponding to a region with amino acids RYNSLSILPAALGKPVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGD |
| Purity/Format | Affinity purified |
| Blocking Peptide | C1ORF93 Blocking Peptide |
| Description | Rabbit polyclonal C1ORF93 antibody raised against the middle region of C1Orf93 |
| Gene | FAM213B |
| Supplier Page | Shop |