| Name | Beta Lactamase antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2527 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Beta Lactamase antibody was raised using the middle region of LACTB corresponding to a region with amino acids QEKEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKNDFEQGELYLREKFE |
| Purity/Format | Affinity purified |
| Blocking Peptide | Beta Lactamase Blocking Peptide |
| Description | Rabbit polyclonal Beta Lactamase antibody raised against the middle region of LACTB |
| Gene | LACTB |
| Supplier Page | Shop |