| Name | U1SNRNPBP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1436 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | U1SNRNPBP antibody was raised using the N terminal of U1SNRNPBP corresponding to a region with amino acids RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | U1SNRNPBP Blocking Peptide |
| Description | Rabbit polyclonal U1SNRNPBP antibody raised against the N terminal of U1SNRNPBP |
| Gene | SNRNP35 |
| Supplier Page | Shop |