| Name | Amphiphysin antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3809 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Amphiphysin antibody was raised using the N terminal of AMPH corresponding to a region with amino acids ADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEA |
| Purity/Format | Affinity purified |
| Blocking Peptide | Amphiphysin Blocking Peptide |
| Description | Rabbit polyclonal Amphiphysin antibody raised against the N terminal of AMPH |
| Gene | AMPH |
| Supplier Page | Shop |