| Name | Cyclin Y-Like 1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5635 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Cyclin Y-Like 1 antibody was raised using the N terminal of CCNYL1 corresponding to a region with amino acids TVKCVTLAIYYHIKNRDANRSLDIFDERSHPLTREKVPEEYFKHDPEHKF |
| Purity/Format | Affinity purified |
| Blocking Peptide | Cyclin Y-Like 1 Blocking Peptide |
| Description | Rabbit polyclonal Cyclin Y-Like 1 antibody raised against the N terminal of CCNYL1 |
| Gene | CCNYL1 |
| Supplier Page | Shop |