| Name | PTPRE antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7313 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PTPRE antibody was raised using the middle region of PTPRE corresponding to a region with amino acids VILSMKRGQEYTDYINASFIDGYRQKDYFIATQGPLAHTVEDFWRMIWEW |
| Purity/Format | Affinity purified |
| Blocking Peptide | PTPRE Blocking Peptide |
| Description | Rabbit polyclonal PTPRE antibody raised against the middle region of PTPRE |
| Gene | PTPRE |
| Supplier Page | Shop |