| Name | CREG2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5475 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | CREG2 antibody was raised using the N terminal of CREG2 corresponding to a region with amino acids VSSVSWAVTNEVDEELDSASTEEAMPALLEDSGSIWQQSFPASAHKEDAH |
| Purity/Format | Affinity purified |
| Blocking Peptide | CREG2 Blocking Peptide |
| Description | Rabbit polyclonal CREG2 antibody raised against the N terminal of CREG2 |
| Gene | CREG2 |
| Supplier Page | Shop |