Name | ACAT2 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1083 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | IHC WB |
Species Reactivities | Human |
Antigen | ACAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPRHGSNIEAMS |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | ACAT2 Blocking Peptide |
Description | Rabbit polyclonal ACAT2 antibody |
Gene | SOAT2 |
Supplier Page | Shop |