GNAZ antibody

Name GNAZ antibody
Supplier Fitzgerald
Catalog 70R-3649
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen GNAZ antibody was raised using a synthetic peptide corresponding to a region with amino acids LIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEIT
Purity/Format Affinity purified
Blocking Peptide GNAZ Blocking Peptide
Description Rabbit polyclonal GNAZ antibody
Gene GNAZ
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.