| Name | PIGA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6607 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PIGA antibody was raised using the middle region of PIGA corresponding to a region with amino acids SVKSLCEGLEKAIFQLKSGTLPAPENIHNIVKTFYTWRNVAERTEKVYDR |
| Purity/Format | Affinity purified |
| Blocking Peptide | PIGA Blocking Peptide |
| Description | Rabbit polyclonal PIGA antibody raised against the middle region of PIGA |
| Gene | PIGA |
| Supplier Page | Shop |